PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN05558.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 308aa    MW: 35322.6 Da    PI: 6.5133
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN05558.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-182067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll+++++++G g+W+  a+  g++Rt+k+c++rw++yl
       KHN05558.1 20 RGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding52.61e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
       KHN05558.1  73 RGNLTPQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.7621567IPR017930Myb domain
SuperFamilySSF466893.74E-3118114IPR009057Homeodomain-like
SMARTSM007172.4E-151969IPR001005SANT/Myb domain
PfamPF002491.6E-162067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-232174IPR009057Homeodomain-like
CDDcd001677.64E-122267No hitNo description
PROSITE patternPS0017503544IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.95368122IPR017930Myb domain
SMARTSM007173.5E-1572120IPR001005SANT/Myb domain
PfamPF002491.3E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2375121IPR009057Homeodomain-like
CDDcd001671.73E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSTIAKRDLS SNEEESELRR GPWTLEEDSL LIHYIARHGE GRWNMLAKSA GLKRTGKSCR  60
LRWLNYLKPD IKRGNLTPQE QLLILELHSK WGNRWSKIAQ HLPGRTDNEI KNYWRTRIQK  120
QARQLNIESG SKRFIDAVKC FWMPRLLQKM EQSNSPSPHH SSMTNMMNLG NSGEASMSSM  180
SSSFNINPSM SSSSSPPQRE FIMDDANHFN TMSNPINPSP DSFQFSQLLE ISEHPKSPSN  240
VFENNVCSYP IQDNCYVDTN NYGMEGINMD PLSAMDTYDF PQFDFQTAGN GWMLDSMGDS  300
TLWNMEAM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26171224108B-MYB
1h8a_C3e-261712224128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535723.10.0PREDICTED: myb-related protein 340-like
SwissprotQ9LK952e-65MYB21_ARATH; Transcription factor MYB21
TrEMBLA0A0B2PD190.0A0A0B2PD19_GLYSO; Transcription factor MYB21
TrEMBLI1LEV60.0I1LEV6_SOYBN; Uncharacterized protein
STRINGGLYMA10G41930.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.15e-84myb domain protein 62
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]